PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.10360s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 202aa    MW: 21962.7 Da    PI: 8.765
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.10360s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.22.5e-3047100155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           +prl+Wtp+LH+rFve+v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Araha.10360s0001.1.p  47 RPRLVWTPQLHKRFVEVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 100
                           59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.59842103IPR017930Myb domain
SuperFamilySSF466895.02E-2044104IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-3046105IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-2448100IPR006447Myb domain, plants
PfamPF002491.5E-85099IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MEEVVDRVGS SSPGSDPKKQ KKSDGGEAAA EEGDSGTEDA SGKTLKRPRL VWTPQLHKRF  60
VEVVAHLGIK NAVPKTIMQL MNVEGLTREN VASHLQKYRL YLKRIQGLTT EEDPYSSDQL  120
FSSTPVPPQS FQDGGGSNGK LGIPVPSMIP VPGYGNQMSM QGHYHQYRSH GNESNQYMMQ  180
RNKFGTMVTS PSVGGGDVID K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-2246105463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0256040.0AB025604.1 Arabidopsis thaliana genomic DNA, chromosome 5, BAC clone:F2O15.
GenBankAB2065770.0AB206577.1 Arabidopsis thaliana PCLL gene for putative transcription factor, complete cds.
GenBankAK1173480.0AK117348.1 Arabidopsis thaliana At5g59570 mRNA for ARR1 like protein, complete cds, clone: RAFL16-91-G07.
GenBankBT0260650.0BT026065.1 Arabidopsis thaliana At5g59570 mRNA, complete cds.
GenBankCP0026880.0CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002864640.11e-130hypothetical protein ARALYDRAFT_496092
SwissprotQ9LTH41e-121PCLL_ARATH; Transcription factor BOA
TrEMBLD7MSG31e-130D7MSG3_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.8__1908__AT5G59570.11e-129(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40552758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59570.11e-107G2-like family protein